| Link type | Probability | Chain b piercings | Chain f piercings | Chain l piercings | Chain x piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
| view details |
|
Other | 30% | -38l -40l -41l -90x -187x +198x -227x -506x | |||||||||||
Chain b Sequence |
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTR |
Chain b Sequence |
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR |
Chain b Sequence |
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN |
Chain b Sequence |
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRS |
| sequence length | 504,34,37,39 |
| structure length | 504,34,37,39 |
| publication title |
Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb |
| molecule tags | Photosynthesis |
| molecule keywords | Photosystem II protein D1 1 |
| pdb deposition date | 2015-10-12 |
| LinkProt deposition date | 2017-02-10 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
