5E79behx

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain b piercings Chain e piercings Chain h piercings Chain x piercings
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
view details
Other Other 34% -85e -506h +67x +120b -139b +220b -40h -41h -90x -187x +198x -227x
Interpreting sequences
Chain b Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTR
Chain b Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Chain b Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Chain b Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRS
sequence length 504,81,65,39
structure length 504,81,65,39
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling