| Link type | Probability | Chain b piercings | Chain e piercings | Chain h piercings | Chain j piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
| view details |
|
Other | 32% | -37e -506h | -19b +120b -133b +221b -258b +270b -427b +451b +40h +229j | -8j | |||||||||
Chain b Sequence |
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTR |
Chain b Sequence |
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK |
Chain b Sequence |
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG |
Chain b Sequence |
SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL |
| sequence length | 504,81,65,38 |
| structure length | 504,81,65,38 |
| publication title |
Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb |
| molecule tags | Photosynthesis |
| molecule keywords | Photosystem II protein D1 1 |
| pdb deposition date | 2015-10-12 |
| LinkProt deposition date | 2017-02-10 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
