5E79bckt

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain b piercings Chain c piercings Chain k piercings Chain t piercings
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
view details
Other Other 44% -474c -506k +28k +506t +25t
Interpreting sequences
Chain b Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTR
Chain b Sequence
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Chain b Sequence
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Chain b Sequence
METITYVFIFACIIALFFFAIFFREPPRIT
sequence length 504,451,37,30
structure length 504,451,37,30
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling