5E79bcix

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain b piercings Chain c piercings Chain i piercings Chain x piercings
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
view details
Other Other 31% -38i -40i -41i -41i -89x -165x -187x +198x -227x -506x -461c +473c
Interpreting sequences
Chain b Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTR
Chain b Sequence
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Chain b Sequence
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE
Chain b Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRS
sequence length 504,451,38,39
structure length 504,451,38,39
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling