5E79Tclt

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain T piercings Chain c piercings Chain l piercings Chain t piercings
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
view details
Other Other 32% -473c -31l -38t -31T -28l -31t -16T -473c +24t
Interpreting sequences
Chain T Sequence
METITYVFIFACIIALFFFAIFFREPPRIT
Chain T Sequence
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Chain T Sequence
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
Chain T Sequence
METITYVFIFACIIALFFFAIFFREPPRIT
sequence length 30,451,37,30
structure length 30,451,37,30
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling