5E79MTcf

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain M piercings Chain T piercings Chain c piercings Chain f piercings
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
view details
Other Other 58% -454M +464M
Interpreting sequences
Chain M Sequence
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQK
Chain M Sequence
METITYVFIFACIIALFFFAIFFREPPRIT
Chain M Sequence
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Chain M Sequence
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
sequence length 34,30,451,34
structure length 34,30,451,34
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling