5E79Lcek

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain L piercings Chain c piercings Chain e piercings Chain k piercings
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
view details
Other Other 31%
Interpreting sequences
Chain L Sequence
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
Chain L Sequence
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Chain L Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Chain L Sequence
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
sequence length 37,451,81,37
structure length 37,451,81,37
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling