Link type | Probability | Chain E piercings | Chain F piercings | Chain V piercings | Chain Y piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V | |||||||||||
view details |
![]() |
Other | 41% | +25F +40V |
Chain E Sequence |
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK |
Chain E Sequence |
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR |
Chain E Sequence |
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY |
Chain E Sequence |
VIAQLTMIAMIGIAGPMIIFLLAVRRGNL |
sequence length | 81,34,137,29 |
structure length | 81,34,137,29 |
publication title |
Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb |
molecule tags | Photosynthesis |
molecule keywords | Photosystem II protein D1 1 |
pdb deposition date | 2015-10-12 |
LinkProt deposition date | 2017-02-10 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...