5E79EFVX

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain E piercings Chain F piercings Chain V piercings Chain X piercings
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
view details
Other Other 38% +32F +84V +40V +84X -138E -45F +40X
Interpreting sequences
Chain E Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Chain E Sequence
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
Chain E Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
Chain E Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRS
sequence length 81,34,137,39
structure length 81,34,137,39
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling