5E79DFLX

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain D piercings Chain F piercings Chain L piercings Chain X piercings
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
view details
Other Other 41% -46F -153L +172L -333L -37X -353D -40L -20X +122X -203X -37D -46F -41X
Interpreting sequences
Chain D Sequence
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Chain D Sequence
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
Chain D Sequence
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
Chain D Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRS
sequence length 342,34,37,39
structure length 342,34,37,39
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling