| Link type | Probability | Chain C piercings | Chain K piercings | Chain L piercings | Chain M piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
| view details |
|
Other | 32% | +36K +72L -87L +298L | +38M -473M | ||||||||||
Chain C Sequence |
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD |
Chain C Sequence |
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR |
Chain C Sequence |
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN |
Chain C Sequence |
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQK |
| sequence length | 451,37,37,34 |
| structure length | 451,37,37,34 |
| publication title |
Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb |
| molecule tags | Photosynthesis |
| molecule keywords | Photosystem II protein D1 1 |
| pdb deposition date | 2015-10-12 |
| LinkProt deposition date | 2017-02-10 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
