5E79CEMh

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain C piercings Chain E piercings Chain M piercings Chain h piercings
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
view details
Other Other 38% -84E -85E -256M -426M +34h +151C -267C +464C -35C -85E
Interpreting sequences
Chain C Sequence
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Chain C Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Chain C Sequence
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQK
Chain C Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
sequence length 451,81,34,65
structure length 451,81,34,65
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling