5E79BLMX

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain B piercings Chain L piercings Chain M piercings Chain X piercings
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
view details
Other Other 61% -19L +37L +27M -60M +70M -109M +326M -506M -27B +120B -41M -503X +35B +4L
Interpreting sequences
Chain B Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTR
Chain B Sequence
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
Chain B Sequence
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQK
Chain B Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRS
sequence length 504,37,34,39
structure length 504,37,34,39
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling