5E79BHKX

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain B piercings Chain H piercings Chain K piercings Chain X piercings
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
view details
Other Other 30% +66H +495K -41K -275X -40X
Interpreting sequences
Chain B Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTR
Chain B Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Chain B Sequence
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Chain B Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRS
sequence length 504,65,37,39
structure length 504,65,37,39
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling