5E79BHKU

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain B piercings Chain H piercings Chain K piercings Chain U piercings
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
view details
Other Other 34% -206K +220K +47U +506B -54K +86K -101K -105K -196U +276U -314U -505U +105U
Interpreting sequences
Chain B Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTR
Chain B Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Chain B Sequence
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Chain B Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
sequence length 504,65,37,97
structure length 504,65,37,97
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling