| Link type | Probability | Chain B piercings | Chain F piercings | Chain T piercings | Chain U piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
| view details |
|
Other | 55% | -45F -505T +30U | +268B | ||||||||||
Chain B Sequence |
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTR |
Chain B Sequence |
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR |
Chain B Sequence |
METITYVFIFACIIALFFFAIFFREPPRIT |
Chain B Sequence |
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK |
| sequence length | 504,34,30,97 |
| structure length | 504,34,30,97 |
| publication title |
Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb |
| molecule tags | Photosynthesis |
| molecule keywords | Photosystem II protein D1 1 |
| pdb deposition date | 2015-10-12 |
| LinkProt deposition date | 2017-02-10 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
