| Link type | Probability | Chain B piercings | Chain C piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 52% | -492C +505C | |||||||||
| view details |
|
Unlink | 52% | -492C +505C | |||||||||
| view details |
|
Unlink | 52% | -492C +505C | |||||||||
| view details |
|
Unlink | 52% | -492C +505C | |||||||||
Chain B Sequence |
QMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLK |
Chain B Sequence |
DEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDA |
| sequence length | 59,61 |
| structure length | 59,61 |
| publication title |
Linear ubiquitination is involved in the pathogenesis of optineurin-associated amyotrophic lateral sclerosis
pubmed doi rcsb |
| molecule tags | Signaling protein |
| molecule keywords | tetra ubiquitin |
| source organism | Homo sapiens |
| pdb deposition date | 2016-06-12 |
| LinkProt deposition date | 2016-09-12 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
