5B70ABD

Oxyr2 e204g regulatory domain from vibrio vulnificus
A: 85-96 B: 87-93 D: 89-95
Link type Probability Chain A piercings Chain B piercings Chain D piercings
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
view details
Other Other 31% -302A -234D -246D +275D -302A -301B
Interpreting sequences
Chain A Sequence
GAM----------MQGQLKLGCIPTIAPFLLCDLVQEINQRFPQLNLLLREDTTTNLLTALRHGELDVLILALPVEIDGMESRVVGQDPFKMVISRHQAGAIKVPIKYDDLPDESVFLLEKGHCLTEHAVSACKLTDKEKINPFSATSLHTLVQMVANGLGTTFIPQMAIDHGLLDNQNLVVIEPPGQQAYRDIGLVWRPSSSRSKTFNQLAEVVSELL
Chain A Sequence
GAMEL-----GDSMQGQLKLGCIPTIAPFLLCDLVQEINQRFPQLNLLLREDTTTNLLTALRHGELDVLILALPVEIDGMESRVVGQDPFKMVISRHQAGAIKVPIKYDDLPDESVFLLEKGHCLTEHAVSACKLTDKEKINPFSATSLHTLVQMVANGLGTTFIPQMAIDHGLLDNQNLVVIEPPGQQAYRDIGLVWRPSSSRSKTFNQLAEVVSELL
Chain A Sequence
GAMELGS-----SMQGQLKLGCIPTIAPFLLCDLVQEINQRFPQLNLLLREDTTTNLLTALRHGELDVLILALPVEIDGMESRVVGQDPFKMVISRHQAGAIKVPIKYDDLPDESVFLLEKGHCLTEHAVSACKLTDKEKINPFSATSLHTLVQMVANGLGTTFIPQMAIDHGLLDNQNLVVIEPPGQQAYRDIGLVWRPSSSRSKTFNQLAEVVSELL
sequence length 219,219,219
structure length 209,214,214
publication title The hydrogen peroxide hypersensitivity of OxyR2 in Vibrio vulnificus depends on conformational constraints
pubmed doi rcsb
molecule tags Transcription
molecule keywords LysR family transcriptional regulator
source organism Vibrio vulnificus
missing residues A: 85-96 B: 87-93 D: 89-95
pdb deposition date2016-06-02
LinkProt deposition date2017-03-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling