5B6FCEFG

Crystal structure of the fab fragment of an anti-leukotriene c4 monoclonal antibody complexed with ltc4
F: 151-158
Link type Probability Chain C piercings Chain E piercings Chain F piercings Chain G piercings
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
view details
Other Other 33% +42F -55F +115F +236G +134G -186G +197G -237G
Interpreting sequences
Chain C Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPKLLIYKVSNRFSGVPERFSGSGSGTDFTLKISRVEAEDLGVYFCSQSKYVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Chain C Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPKLLIYKVSNRFSGVPERFSGSGSGTDFTLKISRVEAEDLGVYFCSQSKYVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Chain C Sequence
EVKLEESGGGLVQPGGSMKLSCVASGFTISNYWMNWVRQSPEKGLDWVAEIRLKSNNYVTHYAESVKGRFTISRDDSKNSVYLQMNNLRPEDTGIYYCTPIYSPFAYWGQGTLVTVSAAKTTPPSVYPLAPG------SMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Chain C Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPKLLIYKVSNRFSGVPERFSGSGSGTDFTLKISRVEAEDLGVYFCSQSKYVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
sequence length 217,216,218,217
structure length 217,216,212,217
publication title Crystal structure of the Fab fragment of an anti-Leukotriene C4 monoclonal antibody complexed with LTC4
rcsb
molecule tags Immune system
molecule keywords anti-leukotriene C4 monoclonal antibody immunoglobulin kappa
missing residues F: 151-158
pdb deposition date2016-05-27
LinkProt deposition date2017-06-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling