| Link type | Probability | Chain d piercings | Chain e piercings | Chain l piercings | Chain t piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
| view details |
|
Other | 46% | +36l -88l +105l -353l | -32l -32l -262t -353t | +38d +84e +32t | |||||||||
Chain d Sequence |
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL |
Chain d Sequence |
GERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK |
Chain d Sequence |
EPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN |
Chain d Sequence |
ETITYVFIFACIIALFFFAIFFREPPRITK |
| sequence length | 342,79,36,30 |
| structure length | 342,79,36,30 |
| publication title |
Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb |
| molecule tags | Electron transport, photosynthesis |
| molecule keywords | Photosystem II protein D1 |
| pdb deposition date | 2016-05-02 |
| LinkProt deposition date | 2017-02-03 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...