5B5Ecjuv

Crystal structure analysis of photosystem ii complex
Link type Probability Chain c piercings Chain j piercings Chain u piercings Chain v piercings
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
view details
Other Other 31% +72u -474u +104v +330c -4u +138u
Interpreting sequences
Chain c Sequence
NSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Chain c Sequence
MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
Chain c Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Chain c Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
sequence length 455,40,97,137
structure length 455,40,97,137
publication title Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
pdb deposition date2016-05-02
LinkProt deposition date2017-02-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling