5B5Ebemu

Crystal structure analysis of photosystem ii complex
b: 484-487
Link type Probability Chain b piercings Chain e piercings Chain m piercings Chain u piercings
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
view details
Other Other 31% -84e -504m -34u -34u -83b -103b +105m +105m +272u
Interpreting sequences
Chain b Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDP--SPEQVEWGFYQKVGDVTT
Chain b Sequence
GERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Chain b Sequence
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQK
Chain b Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
sequence length 503,79,34,97
structure length 501,79,34,97
publication title Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
missing residues b: 484-487
pdb deposition date2016-05-02
LinkProt deposition date2017-02-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling