| Link type | Probability | Chain b piercings | Chain e piercings | Chain h piercings | Chain t piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
| view details |
|
Other | 46% | -85e -85e -64h -78h -250h +266h | +484b -504b -31h +252t -464t -504t | +64b +85e +32t | |||||||||
Chain b Sequence |
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDP--SPEQVEWGFYQKVGDVTT |
Chain b Sequence |
GERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK |
Chain b Sequence |
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA |
Chain b Sequence |
ETITYVFIFACIIALFFFAIFFREPPRITK |
| sequence length | 503,79,63,30 |
| structure length | 501,79,63,30 |
| publication title |
Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb |
| molecule tags | Electron transport, photosynthesis |
| molecule keywords | Photosystem II protein D1 |
| missing residues | b: 484-487 |
| pdb deposition date | 2016-05-02 |
| LinkProt deposition date | 2017-02-03 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
