5B5EMbkl

Crystal structure analysis of photosystem ii complex
b: 484-487
Link type Probability Chain M piercings Chain b piercings Chain k piercings Chain l piercings
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
view details
Other Other 33% +492b -505b +37l
Interpreting sequences
Chain M Sequence
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQK
Chain M Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDP--SPEQVEWGFYQKVGDVTT
Chain M Sequence
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Chain M Sequence
EPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
sequence length 34,503,37,36
structure length 34,501,37,36
publication title Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
missing residues b: 484-487
pdb deposition date2016-05-02
LinkProt deposition date2017-02-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling