| Link type | Probability | Chain H piercings | Chain b piercings | Chain c piercings | Chain j piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
| view details |
|
Other | 31% | -36b -164b -64c -65c | +473H +202b -247b +462b | ||||||||||
Chain H Sequence |
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA |
Chain H Sequence |
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDP--SPEQVEWGFYQKVGDVTT |
Chain H Sequence |
NSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD |
Chain H Sequence |
MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL |
| sequence length | 63,503,455,40 |
| structure length | 63,501,455,40 |
| publication title |
Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb |
| molecule tags | Electron transport, photosynthesis |
| molecule keywords | Photosystem II protein D1 |
| missing residues | b: 484-487 |
| pdb deposition date | 2016-05-02 |
| LinkProt deposition date | 2017-02-03 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
