| Link type | Probability | Chain E piercings | Chain K piercings | Chain X piercings | Chain Y piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
| view details |
|
Other | 43% | -40Y | -5E +47X +16Y | ||||||||||
Chain E Sequence |
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK |
Chain E Sequence |
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR |
Chain E Sequence |
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQR |
Chain E Sequence |
VIAQLTMIAMIGIAGPMIIFLLAVRRGNL |
| sequence length | 81,37,38,29 |
| structure length | 81,37,38,29 |
| publication title |
Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb |
| molecule tags | Electron transport, photosynthesis |
| molecule keywords | Photosystem II protein D1 |
| pdb deposition date | 2016-05-02 |
| LinkProt deposition date | 2017-02-03 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
