5B5EDbh

Crystal structure analysis of photosystem ii complex
b: 484-487
Link type Probability Chain D piercings Chain b piercings Chain h piercings
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
view details
Hopf.1 U Ring Hopf.1 U Ring 31% +35D -19b +120b -133b +221b -250b +452b +505b
Interpreting sequences
Chain D Sequence
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Chain D Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDP--SPEQVEWGFYQKVGDVTT
Chain D Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
sequence length 342,503,63
structure length 342,501,63
publication title Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
missing residues b: 484-487
pdb deposition date2016-05-02
LinkProt deposition date2017-02-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling