5B5EBEce

Crystal structure analysis of photosystem ii complex
Link type Probability Chain B piercings Chain E piercings Chain c piercings Chain e piercings
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
view details
Other Other 34% -9c -461c +478c +491c -473e -506B -29B +473B
Interpreting sequences
Chain B Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRK
Chain B Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Chain B Sequence
NSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Chain B Sequence
GERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
sequence length 505,81,455,79
structure length 505,81,455,79
publication title Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
pdb deposition date2016-05-02
LinkProt deposition date2017-02-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling