Link type | Probability | Chain B piercings | Chain E piercings | Chain M piercings | Chain t piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E | ||||||||||
view details |
![]() |
Other | 32% | +480B -506B | +35B +85E |
Chain B Sequence |
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRK |
Chain B Sequence |
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK |
Chain B Sequence |
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQK |
Chain B Sequence |
ETITYVFIFACIIALFFFAIFFREPPRITK |
sequence length | 505,81,34,30 |
structure length | 505,81,34,30 |
publication title |
Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb |
molecule tags | Electron transport, photosynthesis |
molecule keywords | Photosystem II protein D1 |
pdb deposition date | 2016-05-02 |
LinkProt deposition date | 2017-02-03 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...