| Link type | Probability | Chain B piercings | Chain E piercings | Chain M piercings | Chain t piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
| view details |
|
Other | 32% | +480B -506B | +35B +85E | ||||||||||
Chain B Sequence |
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRK |
Chain B Sequence |
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK |
Chain B Sequence |
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQK |
Chain B Sequence |
ETITYVFIFACIIALFFFAIFFREPPRITK |
| sequence length | 505,81,34,30 |
| structure length | 505,81,34,30 |
| publication title |
Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb |
| molecule tags | Electron transport, photosynthesis |
| molecule keywords | Photosystem II protein D1 |
| pdb deposition date | 2016-05-02 |
| LinkProt deposition date | 2017-02-03 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...