5B5EBDLO

Crystal structure analysis of photosystem ii complex
Link type Probability Chain B piercings Chain D piercings Chain L piercings Chain O piercings
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
view details
Other Other 34% +198D -285D -353D -44L -243L +456L -16O +37O +2B -507B -16L -506O -204D +268D +180O
Interpreting sequences
Chain B Sequence
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRK
Chain B Sequence
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Chain B Sequence
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
Chain B Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
sequence length 505,342,37,243
structure length 505,342,37,243
publication title Two different structures of the oxygen-evolving complex in the same polypeptide frameworks of photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
pdb deposition date2016-05-02
LinkProt deposition date2017-02-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling