5B3SOSWY

Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 k)
Link type Probability Chain O piercings Chain S piercings Chain W piercings Chain Y piercings
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
view details
Other Other 37%
Interpreting sequences
Chain O Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Chain O Sequence
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH
Chain O Sequence
FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHK
Chain O Sequence
HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK
sequence length 226,94,58,46
structure length 226,94,58,46
publication title Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-11
LinkProt deposition date2017-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling