5B3SNRYZ

Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 k)
Link type Probability Chain N piercings Chain R piercings Chain Y piercings Chain Z piercings
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
view details
Other Other 32% -110R -505Y +48Z +9N -95N +145N -44Y +18Z -472Z -514Z +48N +110R -3Z +44Z
Interpreting sequences
Chain N Sequence
FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Chain N Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Chain N Sequence
HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK
Chain N Sequence
ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKS
sequence length 513,105,46,43
structure length 513,105,46,43
publication title Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-11
LinkProt deposition date2017-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling