| Link type | Probability | Chain N piercings | Chain Q piercings | Chain S piercings | Chain X piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
| view details |
|
Other | 40% | +95Q -34S +50S -402S +412S -461S +481S +515S -67X | -514N +35S +515X | -54X | |||||||||
Chain N Sequence |
FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK |
Chain N Sequence |
SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK |
Chain N Sequence |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH |
Chain N Sequence |
APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR |
| sequence length | 513,144,94,49 |
| structure length | 513,144,94,49 |
| publication title |
Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb |
| molecule tags | Oxidoreductase |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2016-03-11 |
| LinkProt deposition date | 2017-03-24 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
