5B3SNQSX

Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 k)
Link type Probability Chain N piercings Chain Q piercings Chain S piercings Chain X piercings
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
view details
Other Other 40% +95Q -34S +50S -402S +412S -461S +481S +515S -67X -514N +35S +515X -54X
Interpreting sequences
Chain N Sequence
FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Chain N Sequence
SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
Chain N Sequence
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH
Chain N Sequence
APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR
sequence length 513,144,94,49
structure length 513,144,94,49
publication title Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-11
LinkProt deposition date2017-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling