| Link type | Probability | Chain F piercings | Chain N piercings | Chain V piercings | Chain Y piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
| view details |
|
Other | 32% | -74F -74F +82N -94N +153N -252N +263N -329N +351N -368N -490N -515N +47Y | |||||||||||
Chain F Sequence |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH |
Chain F Sequence |
FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK |
Chain F Sequence |
TALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK |
Chain F Sequence |
HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK |
| sequence length | 94,513,72,46 |
| structure length | 94,513,72,46 |
| publication title |
Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb |
| molecule tags | Oxidoreductase |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2016-03-11 |
| LinkProt deposition date | 2017-03-24 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
