| Link type | Probability | Chain F piercings | Chain N piercings | Chain V piercings | Chain X piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
| view details |
|
Other | 31% | +508N +35V +74X | +95F | -74F +164N -205N +215N -241N +267N -322N +354N -366N -515N | |||||||||
Chain F Sequence |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH |
Chain F Sequence |
FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK |
Chain F Sequence |
TALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK |
Chain F Sequence |
APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR |
| sequence length | 94,513,72,49 |
| structure length | 94,513,72,49 |
| publication title |
Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb |
| molecule tags | Oxidoreductase |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2016-03-11 |
| LinkProt deposition date | 2017-03-24 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
