Link type | Probability | Chain D piercings | Chain G piercings | Chain I piercings | Chain S piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S | |||||||||
view details |
![]() |
Other | 35% | -27S | -148D | -74D -12G +66S |
Chain D Sequence |
SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK |
Chain D Sequence |
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK |
Chain D Sequence |
TALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK |
Chain D Sequence |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH |
sequence length | 144,84,72,94 |
structure length | 144,83,72,94 |
publication title |
Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb |
molecule tags | Oxidoreductase |
molecule keywords | Cytochrome c oxidase subunit 1 |
pdb deposition date | 2016-03-11 |
LinkProt deposition date | 2017-03-24 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...