| Link type | Probability | Chain C piercings | Chain P piercings | Chain Q piercings | Chain S piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
| view details |
|
Other | 35% | -143P +167P -187P +252P -262P -261Q | +94Q +262S | +94S +94S | |||||||||
Chain C Sequence |
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS |
Chain C Sequence |
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS |
Chain C Sequence |
SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK |
Chain C Sequence |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH |
| sequence length | 259,259,144,94 |
| structure length | 259,259,144,94 |
| publication title |
Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb |
| molecule tags | Oxidoreductase |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2016-03-11 |
| LinkProt deposition date | 2017-03-24 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
