5B3SCFOV

Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 k)
Link type Probability Chain C piercings Chain F piercings Chain O piercings Chain V piercings
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
view details
Other Other 33% +15F +95F +23O +70O -154O -215O +227O +262O -70V -261C +10O -21O -74O -64V +92V -137V +159V -226V -74V
Interpreting sequences
Chain C Sequence
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS
Chain C Sequence
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH
Chain C Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Chain C Sequence
TALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK
sequence length 259,94,226,72
structure length 259,94,226,72
publication title Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-11
LinkProt deposition date2017-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling