Link type | Probability | Chain B piercings | Chain K piercings | Chain P piercings | Chain T piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T | |||||||||||
view details |
![]() |
Other | 30% | -49P -85P -228T -228T |
Chain B Sequence |
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML |
Chain B Sequence |
APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR |
Chain B Sequence |
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS |
Chain B Sequence |
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK |
sequence length | 226,49,259,84 |
structure length | 226,49,259,83 |
publication title |
Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb |
molecule tags | Oxidoreductase |
molecule keywords | Cytochrome c oxidase subunit 1 |
pdb deposition date | 2016-03-11 |
LinkProt deposition date | 2017-03-24 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...