5B3SBIJT

Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 k)
Link type Probability Chain B piercings Chain I piercings Chain J piercings Chain T piercings
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
view details
Other Other 37% +12J -23J +58J -189J +212J -227J +19T
Interpreting sequences
Chain B Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Chain B Sequence
TALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK
Chain B Sequence
FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHK
Chain B Sequence
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK
sequence length 226,72,58,84
structure length 226,72,58,83
publication title Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-11
LinkProt deposition date2017-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling