5B3SBEIL

Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 k)
Link type Probability Chain B piercings Chain E piercings Chain I piercings Chain L piercings
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
view details
Other Other 37% -87L +228L
Interpreting sequences
Chain B Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Chain B Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Chain B Sequence
TALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK
Chain B Sequence
HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK
sequence length 226,105,72,46
structure length 226,105,72,46
publication title Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-11
LinkProt deposition date2017-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling