| Link type | Probability | Chain A piercings | Chain S piercings | Chain T piercings | Chain U piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
| view details |
|
Other | 31% | +5S +515T -85U | -514A | -84A -5S | |||||||||
Chain A Sequence |
FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK |
Chain A Sequence |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH |
Chain A Sequence |
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK |
Chain A Sequence |
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI |
| sequence length | 513,94,84,79 |
| structure length | 513,94,83,79 |
| publication title |
Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb |
| molecule tags | Oxidoreductase |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2016-03-11 |
| LinkProt deposition date | 2017-03-24 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
