| Link type | Probability | Chain A piercings | Chain F piercings | Chain K piercings | Chain L piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
| view details |
|
Other | 30% | +94F +11K +54L +54L | +164A +167A -392A +417A +483A -495A +48K +400L -413L +469L | +23F -92F | |||||||||
Chain A Sequence |
FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK |
Chain A Sequence |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH |
Chain A Sequence |
APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR |
Chain A Sequence |
HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK |
| sequence length | 513,94,49,46 |
| structure length | 513,94,49,46 |
| publication title |
Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb |
| molecule tags | Oxidoreductase |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2016-03-11 |
| LinkProt deposition date | 2017-03-24 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
