5B3SABST

Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 k)
Link type Probability Chain A piercings Chain B piercings Chain S piercings Chain T piercings
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
view details
Other Other 31% -124B +135B -166B +190B -228B -514S +85S +85S +284T -309T +357T +514T
Interpreting sequences
Chain A Sequence
FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Chain A Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Chain A Sequence
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH
Chain A Sequence
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK
sequence length 513,226,94,84
structure length 513,226,94,83
publication title Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-11
LinkProt deposition date2017-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling