5B1SABCD

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2-(2-fluorophenyl)ethanamine
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
view details
Other Other 31% +23B +294C +9A -295A
Interpreting sequences
Chain A Sequence
MPGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Chain A Sequence
MPGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Chain A Sequence
MPGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Chain A Sequence
MPGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
sequence length 294,294,294,294
structure length 294,294,294,294
publication title In silico, in vitro, X-ray crystallography, and integrated strategies for discovery of spermidine synthase inhibitor for an anti-trypanosomiasis drug
rcsb
molecule tags Transferase
molecule keywords Spermidine synthase, putative
source organism Trypanosoma cruzi strain cl brener
pdb deposition date2015-12-17
LinkProt deposition date2017-01-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling