4W2QBCDF

Anti-marburgvirus nucleoprotein single domain antibody c complexed with nucleoprotein c-terminal domain
Link type Probability Loop ranges Chain B piercings Chain C piercings Chain D piercings Chain F piercings
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
view details
Other Other 37% -B -28C -695D +678F +696B -696D -693F -695F
Interpreting sequences
Chain B Sequence
GGSWPQRVVTKKGRTFLYPNDLLQTNPPESLITALVEEYQNPVSAKELQADWPDMSFDERRHVAMNL
Chain B Sequence
KVQLQESGGGLVQVGGSLRLSCKASGFTFRSSAMGWYRRAPGKQRELVASLTTTGTADYGDFVKGRFTISRDNAENTVDLHMNSLKPEDTAVYYCHEDPYGMESLRYWGQGTQVTVS
Chain B Sequence
PQRVVTKKGRTFLYPNDLLQTNPPESLITALVEEYQNPVSAKELQADWPDMSFDERRHVAMNL
Chain B Sequence
GGGSWPQRVVTKKGRTFLYPNDLLQTNPPESLITALVEEYQNPVSAKELQADWPDMSFDERRHVAMNL
sequence length 67,117,63,68
structure length 67,117,63,68
publication title Unveiling a Drift Resistant Cryptotope within Marburgvirus Nucleoprotein Recognized by Llama Single-Domain Antibodies
doi rcsb
molecule tags Immune system
molecule keywords Anti-Marburgvirus Nucleoprotein Single Domain Antibody C
source organism Lama glama
pdb deposition date2017-08-17
LinkProt deposition date2017-10-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling