| Link type | Probability | Loop ranges | N loop piercings | C loop piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Solomon.1 | 100% | 50-179A, 180-262A | -221 -253 | -147 -170 | ||||||||
Chain A Sequence |
SKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNREYDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLI |
| sequence length | 227 |
| structure length | 227 |
| publication title |
The Epithelial Adhesin 1 (Epa1P) from the Human-Pathogenic Yeast Candida Glabrata : Structural and Functional Study of the Carbohydrate-Binding Domain
pubmed doi rcsb |
| molecule tags | Cell adhesion |
| molecule keywords | EPA1P |
| source organism | Candida glabrata |
| pdb deposition date | 2011-10-05 |
| LinkProt deposition date | 2016-08-17 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
