| Link type | Probability | Loop ranges | N loop piercings | C loop piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 | 100% | 39-76B, 79-138B | +97 | +64 | ||||||||
Chain B Sequence |
GAVQLRFDNTYDNASGSMNTVACSTGANGLSQRFPTFGSVPTFPHIGASSDIGGFNSPACGNCYTISFTFQGVTRSINLVAIDHAGNGFNVAQAAMDELTNGNAVALGTIDVQSQQVARSVCGL |
| sequence length | 124 |
| structure length | 124 |
| publication title |
Crystal structure of cerato-platanins from M. perniciosa
rcsb |
| molecule tags | Unknown function |
| molecule keywords | Cerato-platanin-like protein |
| source organism | Moniliophthora perniciosa |
| pdb deposition date | 2011-07-11 |
| LinkProt deposition date | 2016-08-17 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
