Link type | Probability | Chain B piercings | Chain C piercings | Chain D piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C | ||||||||||
view details |
![]() |
Unlink | 33% | +607C +815C -859C -916C |
Chain B Sequence |
DEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS---SVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDF |
Chain B Sequence |
IQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFL |
Chain B Sequence |
IQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFL |
sequence length | 336,327,327 |
structure length | 333,327,327 |
publication title |
Mechanism for the allosteric regulation of phosphodiesterase 2A deduced from the X-ray structure of a near full-length construct.
pubmed doi rcsb |
molecule tags | Hydrolase |
molecule keywords | cGMP-dependent 3',5'-cyclic phosphodiesterase |
source organism | Homo sapiens |
missing residues | B: 720-724 |
ec nomenclature |
ec 3.1.4.17: 3',5'-cyclic-nucleotide phosphodiesterase. ec 3.1.4.17: 3',5'-cyclic-nucleotide phosphodiesterase. ec 3.1.4.17: 3',5'-cyclic-nucleotide phosphodiesterase. |
pdb deposition date | 2009-08-28 |
LinkProt deposition date | 2016-10-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
BCD | PF00233 | PDEase_I | 3'5'-cyclic nucleotide phosphodiesterase |
BCD | PF00233 | PDEase_I | 3'5'-cyclic nucleotide phosphodiesterase |
BCD | PF00233 | PDEase_I | 3'5'-cyclic nucleotide phosphodiesterase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b | Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b | ||
Mainly Alpha | Orthogonal Bundle | Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b | Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b | ||
Mainly Alpha | Orthogonal Bundle | Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b | Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b |
#chains in the LinkProt database with same CATH superfamily 3ITU BC; 3ITU BCD; 3ITU ABC; 3ITU ABCD; 3ITU ACD; 3ITU BD; 3ITU AB; 3ITU ABD; 3ITU CD; 3ITU AD; #chains in the LinkProt database with same CATH topology 3ITU BC; 3ITU BCD; 3ITU ABC; 3ITU ABCD; 3ITU ACD; 3ITU BD; 3ITU AB; 3ITU ABD; 3ITU CD; 3ITU AD; #chains in the LinkProt database with same CATH homology 3ITU BC; 3ITU BCD; 3ITU ABC; 3ITU ABCD; 3ITU ACD; 3ITU BD; 3ITU AB; 3ITU ABD; 3ITU CD; 3ITU AD;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...